PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0408s0140.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB_related
Protein Properties Length: 372aa    MW: 40417.5 Da    PI: 9.4345
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0408s0140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.9e-13110154347
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qk+
  SapurV1A.0408s0140.1.p 110 PWTEEEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKF 154
                             8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.713319IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.102.7E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129420.306103159IPR017930Myb domain
SuperFamilySSF466891.72E-16105160IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-18106158IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-11107150IPR009057Homeodomain-like
SMARTSM007178.2E-10107157IPR001005SANT/Myb domain
PfamPF002494.6E-10110153IPR001005SANT/Myb domain
CDDcd001671.24E-8110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MTRRCSHCSK NGHNSRTCPT RSSLASTSPF PLSGVKLFGV RLTDGSIIKK SASMGNLSAH  60
FHSSSSAAAS PNPGSPVSDR VHDDGYLSDD PAARASCSTS RRGDRKKGVP WTEEEHRLFL  120
IGLQKLGKGD WRGIARNFVV SRTPTQVASH AQKFFIRQSN ATRRKRRSSL FDMAPEMATD  180
PKPVPEEQEL PSSSRAGDAD NVDALPSLNL SLKPEVEPMD TESHELVKES DKTMMGFSEF  240
KPSVPSSNEF VPIASGSNEL TAVPGFSPAY MPLPYPYWAP NTTPFEEVKG AATSHHEVLK  300
PVPIILKEPF NVDQLVGMSH LSLGEIERRH REPSSLSLKL IGEPQRQSAF HARAPSGSDL  360
RNGKASPIQA V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1482410.0EF148241.1 Populus trichocarpa x Populus deltoides clone WS01312_B18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011010432.10.0PREDICTED: uncharacterized protein LOC105115293 isoform X1
TrEMBLA9PIL70.0A9PIL7_9R
STRINGPOPTR_0001s19070.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.12e-96MYB_related family protein